Fantasia of the Unconscious

( 2 )

Overview

This book is part of the TREDITION CLASSICS series. The creators of this series are united by passion for literature and driven by the intention of making all public domain books available in printed format again - worldwide. At tredition we believe that a great book never goes out of style. Several mostly non-profit literature projects provide content to tredition. To support their good work, tredition donates a portion of the proceeds from each sold copy. As a reader of a TREDITION CLASSICS book, you support ...
See more details below
Other sellers (Paperback)
  • All (1) from $19.41   
  • New (1) from $19.41   
Fantasia of the Unconscious (Barnes & Noble Digital Library)

Available on NOOK devices and apps  
  • NOOK Devices
  • NOOK HD/HD+ Tablet
  • NOOK
  • NOOK Color
  • NOOK Tablet
  • Tablet/Phone
  • NOOK for Windows 8 Tablet
  • NOOK for iOS
  • NOOK for Android
  • NOOK Kids for iPad
  • PC/Mac
  • NOOK for Windows 8
  • NOOK for PC
  • NOOK for Mac
  • NOOK Study
  • NOOK for Web

Want a NOOK? Explore Now

NOOK Book (eBook)
$1.99
BN.com price
This digital version does not exactly match the physical book displayed here.
Marketplace
BN.com

All Available Formats & Editions

Overview

This book is part of the TREDITION CLASSICS series. The creators of this series are united by passion for literature and driven by the intention of making all public domain books available in printed format again - worldwide. At tredition we believe that a great book never goes out of style. Several mostly non-profit literature projects provide content to tredition. To support their good work, tredition donates a portion of the proceeds from each sold copy. As a reader of a TREDITION CLASSICS book, you support our mission to save many of the amazing works of world literature from oblivion.
Read More Show Less

Product Details

  • ISBN-13: 9783847228202
  • Publisher: TREDITION CLASSICS
  • Publication date: 2/24/2012
  • Pages: 168
  • Product dimensions: 5.25 (w) x 8.00 (h) x 0.39 (d)

Meet the Author

D. H. Lawrence
Pensive and insightful, D. H. Lawrence brought to his work a frankness that had been missing from early 20th-century fiction. Though novels such as Lady Chatterly's Lover, Sons and Lovers, and others incited controversy and censorship for their sexual content, Lawrence was not being prurient; he was simply trying to describe the world around him, in both his fiction and his many letters and essays.

Biography

Born in Nottinghamshire, England, D. H. Lawrence (1885-1930) was the author of a remarkable array of novels, stories, poetry, literary criticism, and travel writing, including the novels Sons and Lovers, The Rainbow, and Lady Chatterley's Lover.

Author biography courtesy of Penguin Group (USA).

Read More Show Less
    1. Also Known As:
      David Herbert Richard Lawrence. Called "Bert" by his family. Jessie Chambers and Lawrence H. Davison are pseudonyms.
    1. Date of Birth:
      September 11, 1885
    2. Place of Birth:
      Eastwood, Nottinghamshire, England
    1. Date of Death:
      March 2, 1930
    2. Place of Death:
      Vence, France

Customer Reviews

Average Rating 5
( 2 )
Rating Distribution

5 Star

(2)

4 Star

(0)

3 Star

(0)

2 Star

(0)

1 Star

(0)

Your Rating:

Your Name: Create a Pen Name or

Barnes & Noble.com Review Rules

Our reader reviews allow you to share your comments on titles you liked, or didn't, with others. By submitting an online review, you are representing to Barnes & Noble.com that all information contained in your review is original and accurate in all respects, and that the submission of such content by you and the posting of such content by Barnes & Noble.com does not and will not violate the rights of any third party. Please follow the rules below to help ensure that your review can be posted.

Reviews by Our Customers Under the Age of 13

We highly value and respect everyone's opinion concerning the titles we offer. However, we cannot allow persons under the age of 13 to have accounts at BN.com or to post customer reviews. Please see our Terms of Use for more details.

What to exclude from your review:

Please do not write about reviews, commentary, or information posted on the product page. If you see any errors in the information on the product page, please send us an email.

Reviews should not contain any of the following:

  • - HTML tags, profanity, obscenities, vulgarities, or comments that defame anyone
  • - Time-sensitive information such as tour dates, signings, lectures, etc.
  • - Single-word reviews. Other people will read your review to discover why you liked or didn't like the title. Be descriptive.
  • - Comments focusing on the author or that may ruin the ending for others
  • - Phone numbers, addresses, URLs
  • - Pricing and availability information or alternative ordering information
  • - Advertisements or commercial solicitation

Reminder:

  • - By submitting a review, you grant to Barnes & Noble.com and its sublicensees the royalty-free, perpetual, irrevocable right and license to use the review in accordance with the Barnes & Noble.com Terms of Use.
  • - Barnes & Noble.com reserves the right not to post any review -- particularly those that do not follow the terms and conditions of these Rules. Barnes & Noble.com also reserves the right to remove any review at any time without notice.
  • - See Terms of Use for other conditions and disclaimers.
Search for Products You'd Like to Recommend

Recommend other products that relate to your review. Just search for them below and share!

Create a Pen Name

Your Pen Name is your unique identity on BN.com. It will appear on the reviews you write and other website activities. Your Pen Name cannot be edited, changed or deleted once submitted.

 
Your Pen Name can be any combination of alphanumeric characters (plus - and _), and must be at least two characters long.

Continue Anonymously
Sort by: Showing all of 2 Customer Reviews
  • Anonymous

    Posted June 8, 2014

    Jamine

    Gjsvagsgdvvgksqwpwyorhgffvvfkqwgfigwgqgqgprgggglrrjgjfkr

    Was this review helpful? Yes  No   Report this review
  • Anonymous

    Posted November 2, 2011

    No text was provided for this review.

Sort by: Showing all of 2 Customer Reviews

If you find inappropriate content, please report it to Barnes & Noble
Why is this product inappropriate?
Comments (optional)